Tugas 3 ISD


Kota adalahsuatuciptaanperadabanbudayaumatmanusia. Kota sebagaihasildariperadaban yang lahirdaripedesaan, tetapikotaberbedadenganpedesaan, sedangkanmasyarakatkotaadalahsuatukelompokteritorial di manapenduduknyamenyelenggarakankegiatan-kegiatanhidupsepenuhnya, danjugamerupakansuatukelompokterorganisasi yang tinggalsecarakompak di wilayahtertentudanmemilikiderajatinterkomuniti yang tinggi.Permasalahan di kotaadalahpengangguran, rawanpangan, rawan moral danlingkungan. Sedangkan Desa adalahsuatuperwujudanataukesatuangeografi, sosial, ekonomi, politik, dankultural yang terdapat di suatudaerahdalamhubungandanpengaruhnyasecaratimbalbalikdengandaerah lain, sedangkanmasyarakatpedesaanditandaidenganpemilikanikatanperasaanbatin yang kuatsesamawargadesa, yaituperasaansetiapwargaatauanggotamasyarakat yang amatkuat yang hakikatnya, bahwaseseorangmerasamerupakanbagian yang tidakdapatdipisahkandarimasyarakat di manaiahidupdicintaisertamempunyaiperasaanbersediauntukberkorbansetiapwaktu demi masyarakatatauanggotamasyarakat.

Permasalahan yang ada di kotaantaralain :

  1. konflik (pertengkaran),
  2. kontroversi (pertentangan),
  3. kompetisi (persaingan),
  4. kegiatanpadamasyarakatpedesaan, dan
  5. sistemnilaibudaya.


Kasus-kasus yang mencirikankemiskinan di pedesaanadalah :

  1. lemahnyaposisisumberdayaalam,
  2. lemahnyaposisisumberdayamanusia di pedesaan,
  3. kurangnyapenguasaanteknologi,
  4. lemahnyainfrastrukturdanlemahnyaaspekkelembagaan, termasukbudaya, sikap, danmotivasi.


1. Polainteraksisosialpadamasyarakatditentukanolehstruktursosialmasyarakat yang bersangkutan.
2. Polainteraksimasyarakatpedesaanadalahdenganprinsipkerukunan, sedangmasyarakatperkotaanlebihke motif ekonomi, politik, pendidikan, dankadanghierarki.
3. Polainteraksimasyarakatpedesaanbersifathorisontal, sedangkanmasyarakatperkotaanvertikal.
4. Polainteraksimasyarakatkotaadalah individual, sedangkanmasyarakatdesaadalahkebersamaan.
5. Polasolidaritassosialmasyarakatpedesaantimbulkarenaadanyakesamaan-kesamaankemasyarakatan, sedangkanmasyarakatkotaterbentukkarenaadanyaperbedaan-perbedaan yang adadalammasyarakat.


Pengaruhkotaterhadapdesa :

  1. kotamenghasilkanbarang-barang yang dibutuhkandesa
  2. menyediakantenagakerjabidangjasa
  3. memproduksihasilpertaniandesa
  4. penyediafasilitas-fasilitaspendidikan, kesehatan, perdagangan, rekreasi
  5. andildalamterkikisnyabudayadesa

Pengaruhdesaterhadapkota :

  1. penyediatenagakerjakasar
  2. penyediabahan-bahankebutuhankota
  3. merupakan hinterland
  4. penyediaruang (space).


Urbanisasiadalahsuatu proses perpindahanpendudukdaridesakekota.

Urbanisasidilihatdarikacamatasosiologmenunjukkantigagejalasosialyaituurbanisasiitusendiri, detribalisasi, danstabilitas.

Ahliekonomimelihatpadaberalihnyacorakmatapencaharian yang baru di kota yang wujudnya subsistence urbanization sebagaipengganticoraksebelumnyayaitu subsistence agriculture. Ahligeografimelihatnyasebagai

  1. Perkembanganpersentasependuduk yang bertempattinggal di perkotaan, baiksecaramondial, nasional, maupun regional.
  2. Bertambahnyapenduduk yang menjadibermatapencahariannonagraris di pedesaan.
  3. Tumbuhnyasuatupemukimanmenjadikota.
  4. Mekarataumeluasnyastrukturartefaktial-morfologissuatukotakekawasansekelilingnya.
  5. Meluasnyapengaruhsuasanaperekonomiankotakepedesaan.
  6. Meluasnyapengaruhsuasanasosial, psikologis, dankulturalkotakepedesaan; denganperkataan lain meluasnyaanekanilaidannorma urban kekawasan di luarnya.


Faktor-faktor yang mempengaruhiurbanisasi

Faktorpendorong :

  1. timbulnyakemiskinan di kota
  2. kegagalanpanen
  3. peraturanadat yang kuat
  4. kurangnyasaranapendidikanpengembangandiri
  5. perangantarkelompok

Faktorpenarik :

  1. dikotabanyakpekerjaan
  2. pekerjaanlebihsesuaipendidikan
  3. mengangkat status social
  4. pengembanganusaha di luarbidangpertanian
  5. fasilitaspendidikanlebihbanyak
  6. modallebihbanyak
  7. tingkatbudayalebihtinggi


Akibaturbanisasi :

  1. berkurangnyatenagakerja di desa
  2. terbentuknyadaerah suburban
  3. terbentuknyapemukimankumuh
  4. meningkatnya tuna karya


Usaha penanggulanganurbanisasi :

– Lokaljangkapendek :

  1. perbaikanperekonomianpedesaan
  2. pembersihanpemukimankumuh
  3. penataanpemukimankumuh
  4. memperluaslapangankerja
  5. membuatdanmelaksanakanproyekperkotaan

– Lokaljangkapanjang

– Nasionaljangkapendek

– Nasionaljangkapanjang





Perspektiffungsionalismemelihatmasyarakatsebagaisuatusistem yang stabildanselalumengandungkeseimbangan.Sebaliknya, teorikonfliksebagaireaksiterhadapfungsionalismepadatahun 1950-andan 1960-an mengemukakanbahwamasyarakatterdiriataskelompok-kelompok yang bertikai yang seringbertempurhabis-habisan, bukannyasebagaikeluargabesar yang bahagia.





Integrasisosialdikonsepkansebagaisuatu proses ketikakelompok-kelompoksosialdalammasyarakatsalingmenjagakeseimbanganuntukmewujudkankedekatanhubungan-hubungansosial, ekonomimaupunpolitik. Kelompok-kelompoksosialtersebutdapatterwujudatasdasar agama ataukepercayaan, suku, ras, dankelas.Dalamkonteksini, integrasitidakselamanyamenghilangkandiferensiasitetapi yang terpentingadalahmemeliharakesadaranuntukmenjagakeseimbanganhubungan.Pokok-pokokintegrasisosialmenurutDahrendoof (1986) adalah (a) Stabilitas, (b) Fungsikoordinasi, (c) Konsensus, dan (d) Integrasi yang terstrukturdenganbaik.
Sedangkan proses terjadinyaintegrasisosial di masyarakatdapatdikelompokkankedalamtigadimensi, yaitu (1) masyarakatdapatterintegrasi di ataskesepakatansebagianbesaranggotaterhadapnilai-nilaisosialtertentu yang bersifat fundamental dan (2) masyarakatdapatterintegrasikarenasebagianbesaranggotanyaterhimpundalamberbagai unit sosialsekaligus (cross-cutting affiliations). Melaluimekanismedemikian, konflik-konflik yang terjadibaik yang tampakmaupun yang laten, teredamolehloyalitasganda, dan (3) masyarakatdapatterintegrasiatassalingketergantungan di antara unit-unit sosial yang terhimpun di dalamnyauntukmemenuhikebutuhanekonomi. Akibatadanyaperbedaanpemilikandanpenguasaansumberekonomi, seperti kaya, menengah, danmiskin.


Ada duamacammobilitassosialyaituvertikaldanhorisontal. Yang vertikalberhubungandenganperpindahanposisikeatasataukebawah, sedangkan yang horisontalberhubungandenganperpindahandarisatubidangataudimensikebidangataudimensilainnyadalamkelas yang sama. Pengendaliansosial (kontrolsosial) adalahkontrol yang bersifatpsikologikdannonfisik, yaitumerupakantekanan mental terhadapindividu, sehinggaindividuakanbersikapdanbertindaksesuaidenganpenilaiankelompok, karenaiatinggaldalamkelompok. Adapunhasildaripengendaliansosialadalah (a) proses pembentukankepribadiansesuaidengankeinginankelompok, dan (b) kelangsunganhidupataukesatuankelompoklebih.



Individu adalah orang seorangataupribadi yang secarakodratiinginhidupbersamadenganindividulainnya.Satuindividuakanselalumembutuhkanindividulainnya. Masyarakat adalahkumpulanindividu yang salingmembutuhkansatusama lain. Masyarakattidakakanterbentuktanpaadaindividu-individu yang salingmembutuhkansatusama lain. Kumpulan individutidaklahsecaraotomatismenjadimasyarakathukum, misalnyaparapenontonsepak bola, pembelidanpedagang di pasar.Walaupunsudahdapatdisebutsebagaimasyarakattetapimasing-masingindividutidakdiikatolehsatuhukumtertentu yang mewajibkanmerekamengikutiaturan yang diciptakanbersamaolehanggotanya.Masyarakathukumadalahmasyarakat di manaparaanggotanyadiikatolehsatunormaatauaturan hokum tertentusebagaipatokanuntukbersikapdanbertindak. Misalnyamasyarakathukumadat, koperasiataupartaipolitik di manamasing-masinganggotanyaharustundukpadaaturan yang sudahditentukandanjikatidaktunduk, makaindividutersebutdapatdikenakansanksi.Negara adalahkelompoksosial yang mendudukiwilayahataudaerahtertentu yang diorganisasikanolehlembagapolitikdanpemerintah yang sah, mempunyaikedaulatansehinggaberhakmenentukantujuannasionalnegaranya.Lembagapolitikdanpemerintah yang terorganisasikantersebutdibentukatasdasarkehendakbersamadanmerupakanpemegangkekuasaantertinggi agar dapatmencapaitujuanbersama pula.Negara hukum yaitunegara yang menjadikanhukumsebagaikekuasaantertinggi.Hukum yang berlaku di negaratersebutharuslahhukum yang mencerminkankeadilanbagimasyarakatnyadanbukanhukum yang hanyaberpihakkepadamasyarakattertentusajasehinggakedudukansemuaindividuataumasyarakatsama di depanhukum



Leave a Reply

Fill in your details below or click an icon to log in:

WordPress.com Logo

You are commenting using your WordPress.com account. Log Out /  Change )

Google+ photo

You are commenting using your Google+ account. Log Out /  Change )

Twitter picture

You are commenting using your Twitter account. Log Out /  Change )

Facebook photo

You are commenting using your Facebook account. Log Out /  Change )

Connecting to %s